.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gpf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of PA2412 protein determined using ABACUS protocol. To be Published
    Site NESGC
    PDB Id 2gpf Target Id PaT86
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS9010,PF03621, 7075, 3.90.820.10 Molecular Weight 8443.15 Da.
    Residues 72 Isoelectric Point 5.21
    Sequence mtsvfdrddiqfqvvvnheeqysiwpeykeipqgwraagksglkkdclayieevwtdmrplslrqhmdk aag
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gpf
    1. Solution structure of Rv2377c-founding member of the MbtH-like protein family
    GW Buchko, CY Kim, TC Terwilliger, PJ Myler - Tuberculosis, 2010 - Elsevier
     
    2. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch