.
The Open Protein Structure Annotation Network
PDB Keyword
.

2grg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of hypothetical protein yst6499 from Saccharomyces cerevisiae/ Northeast Structural Genomics Consortium Target YT727/ Ontario Center for Structural Proteomics Target yst6499. To be Published
    Site NESGC
    PDB Id 2grg Target Id YT727
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS9264,7085, PF11503 Molecular Weight 10780.80 Da.
    Residues 98 Isoelectric Point 8.93
    Sequence mkssipitevlpravgsltfdenynlldtsgvakviekspiaeiirksnaelgrlgysvyedaqyigha fkkaghfivyftpknknregvvppvgitn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2grg
    1. Identifying and quantifying orphan protein sequences in fungi
    D Ekman, A Elofsson - Journal of molecular biology, 2010 - Elsevier
     
    2. Effect of the electrostatic potential on the internalization mechanism of cell penetrating peptides derived from TIRAP
    KA Flores, JC Salgado, G Zapata-Torres - Biotechnology and , 2012 - Springer
     
    3. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch