.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gsv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hypothetical Protein YvfG from Bacillus subtilis, Northeast Structural Genomics Target SR478. To be Published
    Site NESGC
    PDB Id 2gsv Target Id SR478
    Related PDB Ids 2js1 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9102,PF09628, 15350 Molecular Weight 8471.28 Da.
    Residues 72 Isoelectric Point 8.02
    Sequence mselfsvpyfienlkqhiemnqsedkihamnsyyrsvvstlvqdqltknavvlkriqhldeaynkvkrg esk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.264
    Matthews' coefficent 2.21 Rfactor 0.229
    Waters 75 Solvent Content 44.46

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2gsv
    1. Prediction of protein_glucose binding sites using support vector machines
    H Nassif, H Al_Ali, S Khuri - : Structure, Function, and , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch