.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gsw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative NADPH-dependent Azobenzene FMN-Reductase YhdA from Bacillus subtilis, Northeast Structural Genomics Target SR135. To be Published
    Site NESGC
    PDB Id 2gsw Target Id SR135
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9064,PF03358, 3.40.50.360, PF02525 Molecular Weight 18902.89 Da.
    Residues 174 Isoelectric Point 6.43
    Sequence mnmlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqrvtkadaivl lspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrtvmrgvyanvipkqlvldp vhidvenatvaenikesikelveelsmfakagnpgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.92 Rfree 0.291
    Matthews' coefficent 2.17 Rfactor 0.26
    Waters 43 Solvent Content 43.27

    Ligand Information
    Ligands FMN (FLAVIN) x 4
    Metals

    Jmol

     
    Google Scholar output for 2gsw
    1. Crystal structure of the NADH: quinone oxidoreductase WrbA from Escherichia coli
    SLA Andrade, EV Patridge, JG Ferry - Journal of , 2007 - Am Soc Microbiol
     
    2. Crystal structure of an apo form of Shigella flexneri ArsH protein with an NADPH_dependent FMN reductase activity
    II Vorontsov, G Minasov, JS Brunzelle - Protein , 2007 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch