.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gtc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the hypthetical protein from Bacillus cereus (ATCC 14579). Northeast structural genomics Target BcR11. To be Published
    Site NESGC
    PDB Id 2gtc Target Id BcR11
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS8745,PF01906, 3.30.110.70 Molecular Weight 11034.16 Da.
    Residues 103 Isoelectric Point 4.76
    Sequence mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardiamdemkela kqkganaivgvdvdyevvrdgmlmvavsgtavri
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.30 Rfree 0.294
    Matthews' coefficent 2.19 Rfactor 0.236
    Waters 120 Solvent Content 43.80

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gtc
    1. Solution NMR structure of selenium-binding protein from Methanococcus vannielii
    M Suzuki, DY Lee, N Inyamah, TC Stadtman - Journal of Biological , 2008 - ASBMB
     
    2. A disulphide bridge network within the soluble periplasmic domain determines structure and function of the outer membrane protein RcsF
    VV Rogov, NY Rogova, F Bernhard, F Lhr - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch