.
The Open Protein Structure Annotation Network
PDB Keyword
.

2guj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Three dimensional structure of the protein P54332 from Bacillus Subtilis. Northeast Structural Genomics Consortium target sr353. To be Published
    Site NESGC
    PDB Id 2guj Target Id SR353
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9082,PF09393 Molecular Weight 16354.50 Da.
    Residues 147 Isoelectric Point 4.78
    Sequence malkaqntisgkegrlfldgeemahiktfeanveknksevnimgrrmtghkttgangtgtatfykvtsk fvllmmdyvkkgsdpyftlqavlddqssgrgtervtlydvnfdsakiasldvdsealeeevpftfedfd vpeklsdtf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.00 Rfree 0.285
    Matthews' coefficent 2.71 Rfactor 0.253
    Waters Solvent Content 54.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2guj
    1. The phage _ major tail protein structure reveals a common evolution for long-tailed phages and the type VI bacterial secretion system
    LG Pell, V Kanelis, LW Donaldson - Proceedings of the , 2009 - National Acad Sciences
     
    2. A common evolutionary origin for tailed-bacteriophage functional modules and bacterial machineries
    D Veesler, C Cambillau - Microbiology and Molecular Biology , 2011 - Am Soc Microbiol
     
    3. Crystal Structure of Bacteriophage SPP1 Distal Tail Protein (gp19. 1)
    D Veesler, G Robin, J Lichire, I Auzat - Journal of Biological , 2010 - ASBMB
     
    4. Contractile Tail Machines of Bacteriophages
    PG Leiman, MM Shneider - Viral Molecular Machines, 2012 - Springer
     
    5. Long Noncontractile Tail Machines of Bacteriophages
    AR Davidson, L Cardarelli, LG Pell, DR Radford - Viral Molecular , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch