.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gxf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hypothetical Protein YybH from Bacillus subtilis, Northeast Structural Genomics Target SR506. TO BE PUBLISHED
    Site NESGC
    PDB Id 2gxf Target Id SR506
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9106,3.10.450.50 Molecular Weight 14568.92 Da.
    Residues 129 Isoelectric Point 4.72
    Sequence meqqlkdiisacdlaiqnedfdtlmnyysedavlvvkpgmiargkeeikkafitianyfnhhivptqgk milleagdtvlvlsqtlldsdkkdseyamerratyvfkknaqgewlcvidnsygtdligv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 3.10 Rfree 0.286
    Matthews' coefficent 2.46 Rfactor 0.259
    Waters 33 Solvent Content 49.94

    Ligand Information
    Ligands MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch