The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of UPF0301 PROTEIN SO3346 from Shewanella oneidensis: Northeast Structural Genomics Consortium target SOR39. To be Published
    Site NESGC
    PDB Id 2gzo Target Id SoR39
    Molecular Characteristics
    Source Shewanella oneidensis
    Alias Ids TPS9148,PF02622, 7180, 3.40.1740.10, Molecular Weight 20706.22 Da.
    Residues 187 Isoelectric Point 4.64
    Sequence meslqnhfliampslddtffertviylcehdekgamglvinkplgievnslleqmdlpteqvsadlamg sqvlmggpvsqdrgfvlhtsqpywanstelgsglmlttsrdvltaigskrspdkflvalgyagwsknql eqeladnswltipadhallfdinhedrwqqasrslgfeawqlstqagha
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch