.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gzp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of Q8ZP24 from Salmonella typhimurium LT2. To be Published
    Site NESGC
    PDB Id 2gzp Target Id StR70
    Related PDB Ids 2es7 2jzt 
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS9174,7178, PF07449, 3.40.30.10 Molecular Weight 15060.29 Da.
    Residues 134 Isoelectric Point 4.69
    Sequence mandtpfsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiaellrefpqfd wqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlmrsivdtpaaqetvq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gzp
    1. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch