.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gzx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the TatD deoxyribonuclease MW0446 from Staphylococcus aureus. Northeast Structural Genomics Consortium Target ZR237. To be Published
    Site NESGC
    PDB Id 2gzx Target Id ZR237
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS9272,PF01026, 3.20.20.140 Molecular Weight 29279.77 Da.
    Residues 257 Isoelectric Point 5.10
    Sequence mlidthvhlndeqydddlsevitrareagvdrmfvvgfnkstieramklideydflygiigwhpvdaid fteehlewieslaqhpkvigigemgldyhwdkspadvqkevfrkqialakrlklpiiihnreatqdcid illeehaeevggimhsfsgspeiadivtnklnfyislggpvtfknakqpkevakhvsmerllvetdapy lsphpyrgkrneparvtlvaeqiaelkglsyeevceqttknaeklfnlns
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.286
    Matthews' coefficent 2.22 Rfactor 0.258
    Waters 81 Solvent Content 44.60

    Ligand Information
    Ligands
    Metals NI (NICKEL) x 4

    Jmol

     
    Google Scholar output for 2gzx
    1. Assessment of predictions submitted for the CASP7 function prediction category
    G Lopez, A Rojas, M Tress - : Structure, Function, and , 2007 - Wiley Online Library
     
    2. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    3. Widespread distribution of cell defense against D-aminoacyl-tRNAs
    S Wydau, G Van der Rest, C Aubard, P Plateau - Journal of Biological , 2009 - ASBMB
     
    4. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    5. A score of the ability of a three-dimensional protein model to retrieve its own sequence as a quantitative measure of its quality and appropriateness
    LP Martnez-Castilla, R Rodrguez-Sotres - PloS one, 2010 - dx.plos.org
     
    6. J Cheng - BMC Structural Biology, 2008 - BioMed Central Ltd
    39
     
    7. Re-Annotation of Two Hyperthermophilic Archaea Pyrococcus abyssi GE5 and Pyrococcus furiosus DSM 3638
    J Gao, J Wang - Current microbiology, 2012 - Springer
     
    8. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    9. Cartographie structurale et fonctionnelle de la liaison entre la peptidyl-ARNt hydrolase et son substrat
    G Laurent - 2010 - hal-polytechnique.archives-ouvertes
     
    10. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch