.
The Open Protein Structure Annotation Network
PDB Keyword
.

2h28

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of Phd-Doc, HigA, and YeeU Establish Multiple Evolutionary Links between Microbial Growth-Regulating Toxin-Antitoxin Systems. Structure 18 996-1010 2010
    Site NESGC
    PDB Id 2h28 Target Id ER304
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8841,3.30.450.20, PF06154 Molecular Weight 13682.84 Da.
    Residues 122 Isoelectric Point 5.61
    Sequence msdtlpgttlpddnhdrpwwglpctvtpcfgarlvqegnrlhyladragirglfsdadayhldqafpll mkqlelmltsgelnprhqhtvtlyakgltckadtlsscdyvylavyptpemkn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.253
    Matthews' coefficent 2.34 Rfactor 0.22
    Waters 82 Solvent Content 47.39

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals MG (MAGNESIUM) x 2;CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2h28
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Crystal structures of Phd-Doc, HigA, and YeeU establish multiple evolutionary links between microbial growth-regulating toxin-antitoxin systems
    MA Arbing, SK Handelman, AP Kuzin, G Verdon - Structure, 2010 - Elsevier
     
    3. BuildBetaA system for automatically constructing beta sheets
    N Max, CC Hu, O Kreylos - : Structure, Function, and , 2010 - Wiley Online Library
     
    4. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    5. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    6. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    7. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     
    8. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch