.
The Open Protein Structure Annotation Network
PDB Keyword
.

2h4o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the hypothetical protein from bacillus subtilis (yonk). To be Published
    Site NESGC
    PDB Id 2h4o Target Id SR415
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9094,PF09642 Molecular Weight 7272.91 Da.
    Residues 63 Isoelectric Point 4.79
    Sequence maskkvhqinvkgffdmdvmevteqtkeaeytydfkeilsefngknvsitvkeenelpvkgve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.301
    Matthews' coefficent 2.26 Rfactor 0.263
    Waters 28 Solvent Content 45.68

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2h4o
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    3. T Liu, M Guerquin, R Samudrala - BMC Structural Biology, 2008 - BioMed Central Ltd
    5
     
    4. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    5. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    6. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     
    7. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     
    8. New protein structure prediction method using inter-residue distances and a theoretical investigation of the isomerization of azobenzene and disubstituted
    CR Crecca - 2008 - ufdcimages.uflib.ufl.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch