.
The Open Protein Structure Annotation Network
PDB Keyword
.

2h6l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Three dimensional structure of the hypothetical protein AF0104 at the 2.0 A resolution. To be Published
    Site NESGC
    PDB Id 2h6l Target Id GR103
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS8888,PF03479, 3.30.1330.80 Molecular Weight 15555.13 Da.
    Residues 138 Isoelectric Point 5.10
    Sequence mkvfefevgkgfllrldygkdlvrqieefleekgihaahisaigavrsavigyydqekkeyvkkelmep leilslsgnvsmkdskpfchihvllgkdgevygghlfsaevfacevfvlplsgeaperafdeqtglflw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.00 Rfree 0.237
    Matthews' coefficent 1.86 Rfactor 0.187
    Waters 210 Solvent Content 33.86

    Ligand Information
    Ligands ACY (ACETIC) x 3
    Metals ZN (ZINC) x 3

    Jmol

     
    Google Scholar output for 2h6l
    1. firestarprediction of functionally important residues using structural templates and alignment reliability
    G Lpez, A Valencia, ML Tress - Nucleic acids research, 2007 - Oxford Univ Press
     
    2. Assessment of predictions submitted for the CASP7 function prediction category
    G Lopez, A Rojas, M Tress - : Structure, Function, and , 2007 - Wiley Online Library
     
    3. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    4. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    5. Structural fragments in protein model refinement
    SM Hollup, WR Taylor - Protein and Peptide Letters, 2008 - ingentaconnect.com
     
    6. Structure-based de novo prediction of zinc-binding sites in proteins of unknown function
    W Zhao, M Xu, Z Liang, B Ding, L Niu, H Liu - , 2011 - Oxford Univ Press
     
    7. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    8. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch