.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hc5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of protein YvyC from Bacillus subtilis reveals unexpected structural similarity between two PFAM families. Proteins 76 1037-1041 2009
    Site NESGC
    PDB Id 2hc5 Target Id SR482
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9104,PF03646, 3.30.160.170, 7170 Molecular Weight 13024.15 Da.
    Residues 109 Isoelectric Point 4.88
    Sequence mnierlttlqpvwdrydtqihnqkdndnevpvhqvsytnlaemvgemnkllepsqvhlkfelhdklney yvkviedstnevireippkrwldfyaamteflglfvdekk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hc5
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. An account of the Seventh Meeting of the Worldwide Critical Assessment of Techniques for Protein Structure Prediction
    A Tramontano - FEBS Journal, 2007 - Wiley Online Library
     
    3. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    4. NMR structure of protein YvyC from Bacillus subtilis reveals unexpected structural similarity between two PFAM families
    A Eletsky, DK Sukumaran, R Xiao - Proteins: Structure, , 2009 - Wiley Online Library
     
    5. X Gao, D Bu, J Xu, M Li - BMC structural biology, 2009 - BioMed Central Ltd
    8
     
    6. Quaternion Maps of Global Protein Structure
    AJ Hanson, S Thakur - Journal of Molecular Graphics and Modelling, 2012 - Elsevier
     
    7. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    8. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     
    9. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    10. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch