.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hd3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Functional insights from structural genomics. J.STRUCT.FUNCT.GENOM. 8 37-44 2007
    Site NESGC
    PDB Id 2hd3 Target Id ER316
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8843,2.40.50.220, PF03319 Molecular Weight 9955.98 Da.
    Residues 95 Isoelectric Point 5.58
    Sequence mklavvtgqivctvrhhglahdkllmvemidpqgnpdgqcavaidnigagtgewvllvsgssarqahks etspvdlcvigivdevvsggqvifhk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.29
    Matthews' coefficent 2.18 Rfactor 0.234
    Waters 306 Solvent Content 43.68

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hd3
    1. Crystal structure of the EutL shell protein of the ethanolamine ammonia lyase microcompartment
    M Sagermann, A Ohtaki - Proceedings of the , 2009 - National Acad Sciences
     
    2. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    3. Functional insights from structural genomics
    F Forouhar, A Kuzin, J Seetharaman, I Lee - Journal of structural and , 2007 - Springer
     
    4. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    5. Protein Structure Prediction Using Coarse Grain Force Fields
    N Mahmood, A Torda - 2010 - nasirmaan.com
     
    6. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    7. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     
    8. New protein structure prediction method using inter-residue distances and a theoretical investigation of the isomerization of azobenzene and disubstituted
    CR Crecca - 2008 - ufdcimages.uflib.ufl.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch