.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hep

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the SOS response protein YnzC from Bacillus subtilis. Proteins 72 526-530 2008
    Site NESGC
    PDB Id 2hep Target Id SR384
    Related PDB Ids 3bhp 2jvd 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9088,1.10.287.540, PF05979, 15476, 7225 Molecular Weight 8805.72 Da.
    Residues 77 Isoelectric Point 9.79
    Sequence misnakiarinelaakakagviteeekaeqqklrqeylkgfrssmkntlksvkiidpegndvtpeklkr eqrnnklh
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hep
    1. Structure of a heparin-dependent complex of Hedgehog and Ihog
    JS McLellan, S Yao, X Zheng - Proceedings of the , 2006 - National Acad Sciences
     
    2. Exploring the parameter space of the coarse_grained UNRES force field by random search: Selecting a transferable medium_resolution force field
    Y He, Y Xiao, A Liwo - Journal of computational , 2009 - Wiley Online Library
     
    3. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    4. Construct optimization for protein NMR structure analysis using amide hydrogen/deuterium exchange mass spectrometry
    S Sharma, H Zheng, YJ Huang - Proteins: Structure, , 2009 - Wiley Online Library
     
    5. Solution NMR structure of the SOS response protein YnzC from Bacillus subtilis
    JM Aramini, S Sharma, YJ Huang - Proteins: Structure, , 2008 - Wiley Online Library
     
    6. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    7. Phosphorylated smooth muscle heavy meromyosin shows an open conformation linked to activation
    BAJ Baumann, DW Taylor, Z Huang, F Tama - Journal of molecular , 2011 - Elsevier
     
    8. Protein Structure Prediction Using Coarse Grain Force Fields
    N Mahmood, A Torda - 2010 - nasirmaan.com
     
    9. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    10. An FPGA design for evaluating score function in protein energy calculation
    JM Romero-Ximil, A Diaz-Perez - Field Programmable Logic , 2009 - ieeexplore.ieee.org
     
    11. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     
    12. New protein structure prediction method using inter-residue distances and a theoretical investigation of the isomerization of azobenzene and disubstituted
    CR Crecca - 2008 - ufdcimages.uflib.ufl.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch