.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hfd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Protein chaperones Q8ZP25_SALTY from Salmonella typhimurium and HYAE_ECOLI from Escherichia coli exhibit thioredoxin-like structures despite lack of canonical thioredoxin active site sequence motif. J.STRUCT.FUNCT.GENOM. 9 41-49 2008
    Site NESGC
    PDB Id 2hfd Target Id ER415
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8850,7256, PF07449, 3.40.30.10 Molecular Weight 14889.01 Da.
    Residues 132 Isoelectric Point 4.49
    Sequence msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmigellrefpdyt wqvaiadleqseaigdrfgvfrfpatlvftggnyrgvlngihpwaelinlmrglvepqqeras
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hfd
    1. Chaperones specific for the membrane_bound [NiFe]_hydrogenase interact with the Tat signal peptide of the small subunit precursor in Ralstonia eutropha H16
    T Schubert, O Lenz, E Krause, R Volkmer - Molecular , 2007 - Wiley Online Library
     
    2. Protein chaperones Q8ZP25_SALTY from Salmonella typhimurium and HYAE_ECOLI from Escherichia coli exhibit thioredoxin-like structures despite lack of canonical
    D Parish, J Benach, G Liu, KK Singarapu - Journal of structural and , 2008 - Springer
     
    3. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     
    4. The hows and whys of aerobic H 2 metabolism
    A Parkin, F Sargent - Current Opinion in Chemical Biology, 2012 - Elsevier
     
    5. Development and application of methodology for rapid NMR data collection and protein structure determination
    DM Parish - 2008 - books.google.com
     
    6. Colworth Medal Lecture
    F Sargent - Biochemical Society Transactions, 2007 - 212.250.180.38
     
    7. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch