.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hfq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of protein NE1680 from Nitrosomonas europaea: Northeast Structural Genomics Consortium target NeT5. TO BE PUBLISHED
    Site NESGC
    PDB Id 2hfq Target Id NeT5
    Molecular Characteristics
    Source Nitrosomonas europaea
    Alias Ids TPS8987,7266, PF09630, 3.10.510.10 Molecular Weight 9808.58 Da.
    Residues 85 Isoelectric Point 5.22
    Sequence mqihvydtyvkakdghvmhfdvftdvrddkkaiefakqwlssigeegatvtseecrfchsqkapdevie aikqngyfiykmegcn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hfq
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Guiding conformation space search with an all_atom energy potential
    TJ Brunette, O Brock - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    3. A novel ab-initio genetic-based approach for protein folding prediction
    SRD Torres, DCB Romero, LFN Vasquez - Proceedings of the 9th , 2007 - dl.acm.org
     
    4. BuildBetaA system for automatically constructing beta sheets
    N Max, CC Hu, O Kreylos - : Structure, Function, and , 2010 - Wiley Online Library
     
    5. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    6. Protein Structure Prediction Using Coarse Grain Force Fields
    N Mahmood, A Torda - 2010 - nasirmaan.com
     
    7. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    8. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    9. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     
    10. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     
    11. New protein structure prediction method using inter-residue distances and a theoretical investigation of the isomerization of azobenzene and disubstituted
    CR Crecca - 2008 - ufdcimages.uflib.ufl.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch