.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hg6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of a hypothetical protein from Pseudomonas aeruginosa (Northeast Structural Genomics Consortium Target: PaT4; Ontario Centre for Structural Proteomics Target: PA1123). To be Published
    Site NESGC
    PDB Id 2hg6 Target Id PaT4
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS9007,3.90.1650.10, PF09634, 7193 Molecular Weight 12166.14 Da.
    Residues 106 Isoelectric Point 4.90
    Sequence msitstdicqaadalkgfvgfnrktgryivrfsedsfgmdvaddsitptsefvwssvrddvmrlgreql qilleqninerlnigepllvylrrqdlpeitaqrqlr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hg6
    1. Inside HDAC with HDAC inhibitors
    P Bertrand - European journal of medicinal chemistry, 2010 - Elsevier
     
    2. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    3. Guiding conformation space search with an all_atom energy potential
    TJ Brunette, O Brock - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    4. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    5. Protein Structure Prediction Using Bee Colony Optimization Metaheuristic
    R Fonseca, M Paluszewski, P Winter - Journal of Mathematical Modelling , 2010 - Springer
     
    6. Evolutionary-inspired probabilistic search for enhancing sampling of local minima in the protein energy surface
    BS Olson, A Shehu - Proteome Science, 2012 - biomedcentral.com
     
    7. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    8. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    9. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     
    10. GUIDING PROBABILISTIC SEARCH OF THE PROTEIN CONFORMATIONAL SPACE WITH STRUCTURAL PROFILES
    B OLSON, K MOLLOY, SF HENDI - Journal of Bioinformatics , 2012 - World Scientific
     
    11. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch