.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hg7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of Phage-like element PBSX protein xkdW, Northeast Structural Genomics Consortium Target SR355. TO BE PUBLISHED
    Site NESGC
    PDB Id 2hg7 Target Id SR355
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9083,3.30.56.60, PF09636 Molecular Weight 12727.71 Da.
    Residues 109 Isoelectric Point 4.67
    Sequence milydaimykypnavsrkdfelrndgngsyiekwnlraplptqaeletwweelqknppyeppdqvella qelsqeklarkqleelnktlgnelsdiklsllslkgdyae
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hg7
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    3. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    4. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch