The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Conserved protein MTH1368, Northeast Structural Genomics Consortium Target TT821A. TO BE PUBLISHED
    Site NESGC
    PDB Id 2hga Target Id TT821A
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9213,, PF00595 Molecular Weight 10822.61 Da.
    Residues 103 Isoelectric Point 8.39
    Sequence qpdgvqidsvvpgspaskvltpglviesingmptsnlttysaalktisvgevinittdqgtfhlktgrn pnnssraymgirtsnhlrvrdsvasvlgdtlpfa
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch