.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hi6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of UPF0107 protein AF_0055, Northeast Structural Genomics Consortium Target GR101 (CASP Target). To be Published
    Site NESGC
    PDB Id 2hi6 Target Id GR101
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS8887,7228, 3.50.30.10, PF01989 Molecular Weight 14188.69 Da.
    Residues 132 Isoelectric Point 5.68
    Sequence mkfacraitrgraegealvtkeyisflggidketgivkedceikgesvagrilvfpggkgstvgsyvll nlrkngvapkaiinkktetiiavgaamaeiplvevrdekffeavktgdrvvvnadegyvelie
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hi6
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    3. On the evolutionary origin of the chaperonins
    C Dekker, KR Willison - : Structure, Function, and , 2011 - Wiley Online Library
     
    4. Structural fragments in protein model refinement
    SM Hollup, WR Taylor - Protein and Peptide Letters, 2008 - ingentaconnect.com
     
    5. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    6. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    7. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch