.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hj0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative Alfa Subunit of Citrate Lyase in Complex with Citrate from Streptococcus mutans, Northeast Structural Genomics Target SmR12 (CASP Target). To be Published
    Site NESGC
    PDB Id 2hj0 Target Id SmR12
    Molecular Characteristics
    Source Streptococcus mutans
    Alias Ids TPS9141,3.40.1080.10, 3.40.810.20, PF04223 Molecular Weight 55452.16 Da.
    Residues 511 Isoelectric Point 5.33
    Sequence maenklgrdiprkyanqygvfegelahiksykessrqvkpvkpsddkllssiheaiektrlkdgmtisf hhhfregdyvmnmvldeiakmgikdisiapssianvheplidhikngvvtnitssglrdkvgaaisegi menpviirshggraraiatddihidvaflgapssdaygnangtrgkttcgslgyamidakyadqvvivt dtlvpypntpisipqtdvdyivvvdaigdpegiakgatrytknpkelliaeyaakvitsspyykegfsf qtgtggaslavtrfmreqmikddikanfalggitnamvelleeglvdkildvqdfdhpsavsldrnaek hyeidanmyasplskgsvinqldicvlsalevdtnfnvnvmtgsdgvirgasgghcdtafaakmslvis plvrgriptfvdkvntvitpgtsvdvvvtevgiainpnrpdlieyfkdlkvpqltieelkekayaivgn pqpiqygdkivalieyrdgslidvvrnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.266
    Matthews' coefficent 2.50 Rfactor 0.224
    Waters 115 Solvent Content 50.74

    Ligand Information
    Ligands CIT (CITRIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 2hj0
    1. Sulfonamide-related conformational effects and their importance in structure-based design
    S Senger, C Chan, MA Convery, JA Hubbard - Bioorganic & medicinal , 2007 - Elsevier
     
    2. Crystal structure of 4-hydroxybutyrate CoA-transferase from Clostridium aminobutyricum
    S Macieira, J Zhang, M Velarde, W Buckel - Biological , 2009 - degruyter.com
     
    3. Crystal structure of the complex between 4-hydroxybutyrate CoA-transferase from Clostridium aminobutyricum and CoA
    S Macieira, J Zhang, W Buckel - Archives of microbiology, 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch