.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hj8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the C-terminal domain of the interferon alpha-inducible ISG15 protein from Homo sapiens. Northeast Structural Genomics target HR2873B. To be Published
    Site NESGC
    PDB Id 2hj8 Target Id HR2873B
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8914,PF00240, 3.10.20.90, 7223 Molecular Weight 8900.71 Da.
    Residues 79 Isoelectric Point 5.74
    Sequence deplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfwltfegkpledqlplgeyglkplst vfmnlrlrgg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hj8
    1. Structural and electrostatic properties of ubiquitination and related pathways
    PJ Winn, M Zahran, JN Battey, Y Zhou, RC Wade - Front Biosci, 2007 - bioscience.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch