.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hjj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of protein ykfF from Escherichia coli. Northeast Structural Genomics target ER397. To be Published
    Site NESGC
    PDB Id 2hjj Target Id ER397
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8848,7261, PF06006, 3.30.160.130 Molecular Weight 9013.59 Da.
    Residues 79 Isoelectric Point 8.36
    Sequence mtqsvllppgpftrrqaqavtttysnitleddqgshfrlvvrdtegrmvwrawnfepdageglnryirt sgirtdtatr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hjj
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    3. NMR structure of protein YvyC from Bacillus subtilis reveals unexpected structural similarity between two PFAM families
    A Eletsky, DK Sukumaran, R Xiao - Proteins: Structure, , 2009 - Wiley Online Library
     
    4. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    5. Biochemical and structural insight into the ribonucleoprotein assembly necessary for mobilization of the LINE-1 retrotransposon
    KD Januszyk - 2008 - books.google.com
     
    6. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     
    7. New protein structure prediction method using inter-residue distances and a theoretical investigation of the isomerization of azobenzene and disubstituted
    CR Crecca - 2008 - ufdcimages.uflib.ufl.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch