The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Structure of Bacillus Subtilis Protein YqbF, Northeast Structural Genomics Target SR449. TO BE PUBLISHED
    Site NESGC
    PDB Id 2hjq Target Id SR449
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9099,, 1.10.720.10, 7201 Molecular Weight 11848.83 Da.
    Residues 103 Isoelectric Point 6.59
    Sequence mftaklikgktynvmgitfragvsqtvpkklyeylnenpyfiltqelnnqkddpinyteselkgmnkae hesiisnlgrnpsdfknaderiayilkqidnkge
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch