.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hqv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of AGR_C_4470p from Agrobacterium tumefaciens. Protein Sci. 16 535-538 2007
    Site NESGC
    PDB Id 2hqv Target Id AtR92
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS8739,PF06228, PF05171, 3.40.1570.10 Molecular Weight 20289.00 Da.
    Residues 187 Isoelectric Point 5.38
    Sequence manairlppeaypmsiaaqkndddrqaralaalaekpdgiveaiaakaevapaeilailpqgaavsapa drfdaiwnemrgwgeilmivqtgdivlevpghlpegteshgwfnihgdspigghikkdncaaitfvdrg fhgrrscsvwfmnaaggamfkifvrrdenkellagqlakfeelrdgfrg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.269
    Matthews' coefficent 2.90 Rfactor 0.241
    Waters 67 Solvent Content 57.57

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hqv
    1. Structure and heme binding properties of Escherichia coli O157: H7 ChuX
    MDL Suits, J Lang, GP Pal, M Couture, Z Jia - Protein Science, 2009 - Wiley Online Library
     
    2. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     
    3. Structural determination and functional annotation of ChuS and ChuX, two members of the heme utilization operon in pathogenic Escherichia coli O157: H7
    MDL Suits - 2007 - qspace.library.queensu.ca
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch