.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hzb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of the hypothetical UPF0052 protein BH3568 from Bacillus halodurans. Northeast Structural Genomics Consortium BhR60. To be Published
    Site NESGC
    PDB Id 2hzb Target Id BhR60
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS8764,3.40.50.10680, 3.40.50.360, PF01933 Molecular Weight 34433.85 Da.
    Residues 322 Isoelectric Point 7.10
    Sequence mkkknvvvfgggtglsvllrglktfpvsitaivtvaddggssgrlrkeldipppgdvrnvlvalsevep lleqlfqhrfengnglsghslgnlllagmtsitgdfargisemskvlnvrgkvlpasnrsiilhgemed gtivtgessipkagkkikrvfltpkdtkplregleairkadvivigpgslytsvlpnllvpgiceaikq starkvyicnvmtqngetdgytasdhlqaimdhcgvgivddilvhgepisdtvkakyakekaepvivde hklkalgvgtisdyfvleqddvlrhnaskvseailegkprtsssiq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.239
    Matthews' coefficent 2.92 Rfactor 0.185
    Waters 135 Solvent Content 57.91

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hzb
    1. Molecular insights into the biosynthesis of the F420 coenzyme
    F Forouhar, M Abashidze, H Xu, LL Grochowski - Journal of Biological , 2008 - ASBMB
     

    Protein Summary

    See the TOPSAN PF01933 groups page for details.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch