.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i4r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the V-type ATP synthase subunit F from Archaeoglobus fulgidus. To be Published
    Site NESGC
    PDB Id 2i4r Target Id GR52A
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS8894,PF01990, 3.40.50.10580 Molecular Weight 10072.10 Da.
    Residues 91 Isoelectric Point 4.64
    Sequence lavvgdpdftigfmlagisdiyevtsdeeivkavedvlkrddvgvviikqeylkklppvlrreidekve ptfvsvggtggveeirekirka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.255
    Matthews' coefficent 2.33 Rfactor 0.227
    Waters 9 Solvent Content 47.15

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2i4r
    1. Crystallization and preliminary X-ray crystallographic analysis of subunit F (F1-94), an essential coupling subunit of the eukaryotic V1VO-ATPase from Saccharomyces
    S Basak, AM Balakrishna - Section F: Structural , 2012 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch