.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ibo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the hypothetical protein SP2199 from Streptococcus pneumoniae, Northeast structural genomics target SpR31. To be Published
    Site NESGC
    PDB Id 2ibo Target Id SpR31
    Molecular Characteristics
    Source Streptococcus pneumoniae
    Alias Ids TPS9160,3.30.70.930, PF01910 Molecular Weight 10717.82 Da.
    Residues 96 Isoelectric Point 4.30
    Sequence mkasialqvlplvqgidriavidqviaylqtqevtmvvtpfetvlegefdelmrilkealevagqeadn vfanvkinvgeilsideklekytetth
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.285
    Matthews' coefficent 3.46 Rfactor 0.243
    Waters 109 Solvent Content 64.41

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ibo
    1. Applications of Bioinformatics to Protein Structures: How Protein Structure and Bioinformatics Overlap
    GW Han, C Rife, MR Sawaya - Methods in Molecular Biology, 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch