.
The Open Protein Structure Annotation Network
PDB Keyword
.

2icp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the bacterial antitoxin HigA from Escherichia coli. To be Published
    Site NESGC
    PDB Id 2icp Target Id ER390
    Related PDB Ids 2ict 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8846,1.10.260.40, PF01381 Molecular Weight 10685.78 Da.
    Residues 97 Isoelectric Point 8.21
    Sequence mkmanhprpgdiiqesldelnvslrefarameiapstasrlltgkaaltpemaiklsvvigsspqmwln lqnawslaeaektvdvsrlrrlvtqstp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.88 Rfree 0.225
    Matthews' coefficent 1.85 Rfactor 0.184
    Waters 74 Solvent Content 33.67

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2icp
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Crystal structures of Phd-Doc, HigA, and YeeU establish multiple evolutionary links between microbial growth-regulating toxin-antitoxin systems
    MA Arbing, SK Handelman, AP Kuzin, G Verdon - Structure, 2010 - Elsevier
     
    3. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    4. Union of geometric constraint-based simulations with molecular dynamics for protein structure prediction
    TJ Glembo, SB Ozkan - Biophysical journal, 2010 - Elsevier
     
    5. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    6. Iterative assembly of helical proteins by optimal hydrophobic packing
    GA Wu, EA Coutsias, KA Dill - Structure, 2008 - Elsevier
     
    7. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     
    8. New protein structure prediction method using inter-residue distances and a theoretical investigation of the isomerization of azobenzene and disubstituted
    CR Crecca - 2008 - ufdcimages.uflib.ufl.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch