.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ict

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of Phd-Doc, HigA, and YeeU Establish Multiple Evolutionary Links between Microbial Growth-Regulating Toxin-Antitoxin Systems. Structure 18 996-1010 2010
    Site NESGC
    PDB Id 2ict Target Id ER390
    Related PDB Ids 2icp 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8847,1.10.260.40, PF01381 Molecular Weight 10685.78 Da.
    Residues 97 Isoelectric Point 8.21
    Sequence mkmanhprpgdiiqesldelnvslrefarameiapstasrlltgkaaltpemaiklsvvigsspqmwln lqnawslaeaektvdvsrlrrlvtqstp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.63 Rfree 0.201
    Matthews' coefficent 2.26 Rfactor 0.198
    Waters 96 Solvent Content 45.59

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ict
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Toxin-antitoxin systems in bacteria and archaea
    Y Yamaguchi, JH Park, M Inouye - Annual review of genetics, 2011 - annualreviews.org
     
    3. Crystal structures of Phd-Doc, HigA, and YeeU establish multiple evolutionary links between microbial growth-regulating toxin-antitoxin systems
    MA Arbing, SK Handelman, AP Kuzin, G Verdon - Structure, 2010 - Elsevier
     
    4. New protein structure prediction method using inter-residue distances and a theoretical investigation of the isomerization of azobenzene and disubstituted
    CR Crecca - 2008 - ufdcimages.uflib.ufl.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch