.
The Open Protein Structure Annotation Network
PDB Keyword
.

2id1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title
    Site NESGC
    PDB Id 2id1 Target Id CvR5
    Molecular Characteristics
    Source Chromobacterium violaceum
    Alias Ids TPS8810,PF02410, 3.30.460.10 Molecular Weight 13192.39 Da.
    Residues 122 Isoelectric Point 4.72
    Sequence meiqeisklaiealedikgkdiieldtskltslfqrmivatgdsnrqvkalansvqvklkeagvdivgs eghesgewvlvdagdvvvhvmlpavrdyydiealwggqkpsfavgaakpwsav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.00 Rfree 0.269
    Matthews' coefficent 2.17 Rfactor 0.228
    Waters 13 Solvent Content 43.39

    Ligand Information
    Ligands
    Metals IOD (IODIDE) x 2

    Jmol

     
    Google Scholar output for 2id1
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. A coarse-grained Langevin molecular dynamics approach to de novo protein structure prediction
    TN Sasaki, H Cetin, M Sasai - Biochemical and biophysical research , 2008 - Elsevier
     
    3. C7orf30 is necessary for biogenesis of the large subunit of the mitochondrial ribosome
    J Rorbach, PA Gammage, M Minczuk - Nucleic Acids Research, 2012 - Oxford Univ Press
     
    4. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    5. C7orf30 specifically associates with the large subunit of the mitochondrial ribosome and is involved in translation
    BFJ Wanschers, R Szklarczyk, A Pajak - Nucleic Acids , 2012 - Oxford Univ Press
     
    6. RsfA (YbeB) Proteins Are Conserved Ribosomal Silencing Factors
    R Huser, M Pech, J Kijek, H Yamamoto, B Titz - PLoS Genetics, 2012 - dx.plos.org
     
    7. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    8. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch