.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ida

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RPA1320. To be Published
    Site NESGC
    PDB Id 2ida Target Id RpT3
    Molecular Characteristics
    Source Rhodopseudomonas palustris
    Alias Ids TPS9053,7297, PF02148, 3.30.40.10 Molecular Weight 11411.50 Da.
    Residues 102 Isoelectric Point 6.47
    Sequence mtmgcrhvagirtvtpsalgceeclkigspwvhlricrtcghvgccddsphkhatrhfhatghpiiegy dppegwgwcyvdevmfdlsdrmtphngpipryv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2ida
    1. Functional diversification of the RING finger and other binuclear treble clef domains in prokaryotes and the early evolution of the ubiquitin system
    AM Burroughs, LM Iyer, L Aravind - Mol. BioSyst., 2011 - xlink.rsc.org
     
    2. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch