.
The Open Protein Structure Annotation Network
PDB Keyword
.

2idb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of 3-octaprenyl-4-hydroxybenzoate decarboxylase (UbiD) from Escherichia coli, Northeast Structural Genomics Target ER459. TO BE PUBLISHED
    Site NESGC
    PDB Id 2idb Target Id ER459
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8852,3.40.1670.10, 1.20.5.570, PF01977 Molecular Weight 55600.82 Da.
    Residues 497 Isoelectric Point 5.31
    Sequence mdamkyndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcnlfgt pkrvamgmgqedvsalrevgkllaflkepeppkgfrdlfdklpqfkqvlnmptkrlrgapcqqkivsgd dvdlnripimtcwpedaaplitwgltvtrgphkerqnlgiyrqqligknklimrwlshrggaldyqewc aahpgerfpvsvalgadpatilgavtpvpdtlseyafagllrgtktevvkcisndlevpasaeivlegy ieqgetapegpygdhtgyynevdsfpvftvthitqredaiyhstytgrppdepavlgvalnevfvpilq kqfpeivdfylppegcsyrlavvtikkqyaghakrvmmgvwsflrqfmytkfvivcdddvnardwndvi waittrmdpardtvlventpidyldfaspvsglgskmgldatnkwpgetqrewgrpikkdpdvvahida iwdelaifnngksa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.90 Rfree 0.265
    Matthews' coefficent 2.91 Rfactor 0.201
    Waters 154 Solvent Content 57.69

    Ligand Information
    Ligands 1PE (PENTAETHYLENE) x 3;EDO (1,2-ETHANEDIOL) x 3
    Metals

    Jmol

     
    Google Scholar output for 2idb
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Cradle-loop barrels and the concept of metafolds in protein classification by natural descent
    V Alva, KK Koretke, M Coles, AN Lupas - Current opinion in structural , 2008 - Elsevier
     
    3. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    4. BuildBetaA system for automatically constructing beta sheets
    N Max, CC Hu, O Kreylos - : Structure, Function, and , 2010 - Wiley Online Library
     
    5. OPUS-Dom: Applying the Folding-Based Method VECFOLD to Determine Protein Domain Boundaries
    Y Wu, AD Dousis, M Chen, J Li, J Ma - Journal of molecular biology, 2009 - Elsevier
     
    6. BCL:: ContactLow Confidence Fold Recognition Hits Boost Protein Contact Prediction and De Novo Structure Determination
    M Karaka_, N Woetzel, J Meiler - Journal of Computational , 2010 - online.liebertpub.com
     
    7. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    8. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch