.
The Open Protein Structure Annotation Network
PDB Keyword
.

2iee

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of probable ABC transporter extracellular-binding protein yckB from Bacillus subtilis. To be Published
    Site NESGC
    PDB Id 2iee Target Id SR574
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9110,PF00497, 3.40.190.10, PF09084 Molecular Weight 29025.39 Da.
    Residues 263 Isoelectric Point 6.77
    Sequence msgkneadskdtgweqikdkgkivvatsgtlyptsyhdtdsgsdkltgyevevvreaakrlglkvefke mgidgmltavnsgqvdaaandidvtkdreekfafstpykysygtaivrkddlsgiktlkdlkgkkaaga attvymevarkygakeviydnatneqylkdvangrtdvilndyylqtlalaafpdlnitihpdikympn kqalvmkksnaalqkkmnealkemskdgsltklskqffnkadvskkidadvqdvdl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.241
    Matthews' coefficent 2.38 Rfactor 0.202
    Waters 190 Solvent Content 48.29

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2iee
    1. Crystal structures of two solute receptors for L-cystine and L-cysteine, respectively, of the human pathogen Neisseria gonorrhoeae
    H Bulut, S Moniot, A Licht, F Scheffel - Journal of Molecular , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch