.
The Open Protein Structure Annotation Network
PDB Keyword
.

2if2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title
    Site NESGC
    PDB Id 2if2 Target Id QR72
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS9042,PF01121, 3.40.50.300 Molecular Weight 22929.26 Da.
    Residues 196 Isoelectric Point 6.86
    Sequence mkrigltgnigcgkstvaqmfrelgayvldadklihsfyrkghpvyeevvktfgkgildeegnidrkkl adivfkdeeklrkleeithralykeiekitknlsedtlfileasllvekgtyknydklivvyapyevck eraikrgmseedferrwkkqmpieekvkyadyvidnsgsieetykqvkkvyeeltrdp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.00 Rfree 0.284
    Matthews' coefficent 2.91 Rfactor 0.235
    Waters 7 Solvent Content 57.68

    Ligand Information
    Ligands SO4 (SULFATE) x 3;EDO (1,2-ETHANEDIOL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch