.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ifa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title
    Site NESGC
    PDB Id 2ifa Target Id SmR5
    Molecular Characteristics
    Source Streptococcus mutans
    Alias Ids TPS9143,3.40.109.10, PF00881 Molecular Weight 22383.17 Da.
    Residues 200 Isoelectric Point 4.94
    Sequence msnfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdfwnkiayse lekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqpwseqahgialyaiwlal aeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsieapagekefmadqerfkvfgd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.30 Rfree 0.273
    Matthews' coefficent 2.26 Rfactor 0.218
    Waters 491 Solvent Content 45.66

    Ligand Information
    Ligands FMN (FLAVIN) x 6
    Metals

    Jmol

     
    Google Scholar output for 2ifa
    1. Structure and function of CinD (YtjD) of Lactococcus lactis, a copper-induced nitroreductase involved in defense against oxidative stress
    M Mermod, F Mourlane, S Waltersperger - Journal of , 2010 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch