.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ift

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the putative methylase HI0767 from Haemophilus influenzae. To be Published
    Site NESGC
    PDB Id 2ift Target Id IR102
    Molecular Characteristics
    Source Haemophilus influenzae
    Alias Ids TPS8932,PF05175, 3.40.50.150, PF03602, PF01564 Molecular Weight 22000.20 Da.
    Residues 193 Isoelectric Point 8.70
    Sequence mkkiqtpnakgevriiaglwrgrklpvlnseglrptgdrvketlfnwlmpyihqsecldgfagsgslgf ealsrqakkvtfleldktvanqlkknlqtlkcsseqaevinqssldflkqpqnqphfdvvfldppfhfn laeqaisllcennwlkpnaliyvetekdkplitpenwtllkekttgivsyrlyqn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.266
    Matthews' coefficent 2.02 Rfactor 0.223
    Waters 107 Solvent Content 39.03

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ift
    1. COMPASS server for remote homology inference
    RI Sadreyev, M Tang, BH Kim - Nucleic acids research, 2007 - Oxford Univ Press
     
    2. Structural and Functional Characterization of Rv2966c Protein Reveals an RsmD-like Methyltransferase from Mycobacterium tuberculosis and the Role of Its N-
    A Kumar, K Saigal, K Malhotra, KM Sinha - Journal of Biological , 2011 - ASBMB
     
    3. Structural and functional characterization of Rv2966c reveals an RsmD-like methyltransferase from M. tuberculosis and the role of its N-terminal domain in target
    A Kumar, K Saigal, K Malhotra, KM Sinha - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch