.
The Open Protein Structure Annotation Network
PDB Keyword
.

2in1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Human Ubiquitin fold conjugating enzyme 1 (Ufc1), Northeast Structural Genomics Target HR41. To be Published
    Site NESGC
    PDB Id 2in1 Target Id HR41
    Related PDB Ids 3evx 3e2g 1ywz 2k07 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8917,6546 Molecular Weight 19457.41 Da.
    Residues 167 Isoelectric Point 6.91
    Sequence madeatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnkegtrwfgkcw yihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdhfkplwarnvpkfglahlma lglgpwlaveipdliqkgviqhkekcnq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.284
    Matthews' coefficent 2.07 Rfactor 0.266
    Waters 128 Solvent Content 40.61

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch