.
The Open Protein Structure Annotation Network
PDB Keyword
.

2in5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the hypothetical lipoprotein YmcC from Escherichia coli (K12), Northeast Structural Genomics target ER552. TO BE PUBLISHED
    Site NESGC
    PDB Id 2in5 Target Id ER552
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8857,PF11102, 2.40.360.10 Molecular Weight 22650.42 Da.
    Residues 199 Isoelectric Point 5.92
    Sequence mthsqqsmvdtfraslfdnqditvadqqiqalpystmylrlnegqrifvvlgyieqeqskwlsqdnaml vthngrllktvklnnnllevtnsgqdplrnalaikdgsrwtrdilwsednhfrsatlsstfsfagletl niagrnvlcnvwqeevtstrpekqwqntfwvdsatgqvrqsrqmlgagvipvemtflkpap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.256
    Matthews' coefficent 3.06 Rfactor 0.215
    Waters 212 Solvent Content 59.85

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2in5
    1. Crystal structure of E. coli group 4 capsule protein GfcC reveals a domain organization resembling Wza
    K Sathiyamoorthy, E Mills, TM Franzmann - Biochemistry, 2011 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch