.
The Open Protein Structure Annotation Network
PDB Keyword
.

2inw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of Phd-Doc, HigA, and YeeU Establish Multiple Evolutionary Links between Microbial Growth-Regulating Toxin-Antitoxin Systems. Structure 18 996-1010 2010
    Site NESGC
    PDB Id 2inw Target Id SfR137
    Molecular Characteristics
    Source Shigella flexneri
    Alias Ids TPS9127,3.30.450.20, PF06154 Molecular Weight 13729.84 Da.
    Residues 125 Isoelectric Point 5.60
    Sequence msdtlpgttppddnhdrpwwglpctvtpcfgarlvqegnrlhyladragirgrfsdvdayhldqafpll mkqlelmltggelnprhqhtvtlyakgltceadtlgscgyvylavyptpaapattv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.25
    Matthews' coefficent 2.15 Rfactor 0.225
    Waters 252 Solvent Content 42.90

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2inw
    1. Crystal structures of Phd-Doc, HigA, and YeeU establish multiple evolutionary links between microbial growth-regulating toxin-antitoxin systems
    MA Arbing, SK Handelman, AP Kuzin, G Verdon - Structure, 2010 - Elsevier
     
    2. Asymmetric Synthesis of Pochonin E and F, Revision of Their Proposed Structure, and Their Conversion to Potent Hsp90 Inhibitors
    G Karthikeyan, C Zambaldo - -A European Journal, 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch