.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jn6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of protein Cgl2762 from Corynebacterium glutamicum implicated in DNA transposition reveals a helix-turn-helix motif attached to a flexibly disordered leucine zipper. Proteins 70 1650-1654 2008
    Site NESGC
    PDB Id 2jn6 Target Id CgR3
    Molecular Characteristics
    Source Corynebacterium glutamicum
    Alias Ids TPS8796,PF01527, 1.10.10.60, 15086, 1.10.1680.10 Molecular Weight 9959.59 Da.
    Residues 89 Isoelectric Point 8.85
    Sequence mptktyseefkrdavalyensdgaslqqiandlginrvtlknwiikygsnhnvqgttpsaavseaeqir qlkkenalqrartrhpaesc
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jn6
    1. PACSY, a relational database management system for protein structure and chemical shift analysis
    W Lee, W Yu, S Kim, I Chang, W Lee - Journal of Biomolecular , 2012 - Springer
     
    2. NMR structure of protein Cgl2762 from Corynebacterium glutamicum implicated in DNA transposition reveals a helix_turn_helix motif attached to a flexibly disordered
    KK Singarapu, R Xiao, DK Sukumaran - Proteins: Structure, , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch