The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR solution structure of E.Coli hypothetical protein YFJZ. To be Published
    Site NESGC
    PDB Id 2jn7 Target Id ER411
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8849,3.30.450.20, 15088, PF06154 Molecular Weight 11736.66 Da.
    Residues 105 Isoelectric Point 6.02
    Sequence msnttwglqrditprlgarlvqegnqlhyladrasitgkfsdaecpkldvvfphfisqiesmlttgeln prhaqcvtlyhngftceadtlgscgyvyiavyptqr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2jn7
    1. Crystal structures of Phd-Doc, HigA, and YeeU establish multiple evolutionary links between microbial growth-regulating toxin-antitoxin systems
    MA Arbing, SK Handelman, AP Kuzin, G Verdon - Structure, 2010 - Elsevier

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch