.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jn8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of Q8ZRJ2 from Salmonella typhimurium. Northeast Structural Genomics target StR65. To be Published
    Site NESGC
    PDB Id 2jn8 Target Id StR65
    Related PDB Ids 2es9 
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS9172,PF08986, 15089 Molecular Weight 11858.01 Da.
    Residues 107 Isoelectric Point 5.66
    Sequence mvnfkdksmptaiekaldfiggmntsasvphsmdestakgilkylhdlgvpvspevvvargeqegwnpe ftkkvagwaekvasgnriliknpeyfstymqeqlkelv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch