.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jn9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR solution structure of YkvR protein from Bacillus subtilis: NESG target SR358. To be Published
    Site NESGC
    PDB Id 2jn9 Target Id SR358
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9084,PF11514, 15217, 2.40.30.80 Molecular Weight 11062.80 Da.
    Residues 96 Isoelectric Point 4.52
    Sequence mktlrlnnvtlemaayqeesepkrkiaftlnvtsetyhdiavllyektfnvevperdlafrgemtnyst sltnlyepgavsefyieiteidknads
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jn9
    1. 4D prediction of protein 1 H chemical shifts
    J Lehtivarjo, T Hassinen, SP Korhonen - Journal of biomolecular , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch