.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jna

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Salmonella typhimurium LT2 Secreted Protein STM0082: Northeast Structural Genomics Consortium Target StR109. To be Published
    Site NESGC
    PDB Id 2jna Target Id StR109
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS9167,3.30.70.1310, PF07338, 3.30.1660.10, 15090 Molecular Weight 10302.16 Da.
    Residues 96 Isoelectric Point 8.96
    Sequence mkkriiaaallatvasfstlaaeqvskqeishfklvkvgtinvsqsggqisspsdlreklseladakgg kyyhiiaarehgpnfeavaevyndatk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jna
    1. Influence of 1 H chemical shift assignments of the interface residues on structure determinations of homodimeric proteins
    YJ Lin, DK Kirchner, P Gntert - Journal of Magnetic Resonance, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch