.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jne

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of E.coli YfgJ bound to two Zn+2. To be Published
    Site NESGC
    PDB Id 2jne Target Id ER317
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8844,15100, PF07191, 2.10.290.10 Molecular Weight 9192.22 Da.
    Residues 83 Isoelectric Point 6.34
    Sequence mnvegmatggihmelhcpqcqhvldqdngharcrscgefiemkalcpdchqplqvlkacgavdyfcqhg hgliskkrvefvla
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2jne
    1. Crystal structure of Bacillus stearothermophilus UvrA provides insight into ATP-modulated dimerization, UvrB interaction, and DNA binding
    D Pakotiprapha, Y Inuzuka, BR Bowman - Molecular cell, 2008 - Elsevier
     
    2. The bridge-region of the Ku superfamily is an atypical zinc ribbon domain
    S Krishna, L Aravind - Journal of structural biology, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch