.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jng

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Conserved CPH Domains of Cul7 and PARC Are Protein-Protein Interaction Modules That Bind the Tetramerization Domain of p53. J.Biol.Chem. 282 11300-11307 2007
    Site NESGC
    PDB Id 2jng Target Id HT1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8926,PF11515, 2.30.30.30, 15109 Molecular Weight 11589.23 Da.
    Residues 101 Isoelectric Point 4.36
    Sequence rsefasgntyalyvrdtlqpgmrvrmlddyeeisagdegefrqsnngvppvqvfwestgrtywvhwhml eilgfeediedmveadeyqgavasrvlgralp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jng
    1. Sequence specific resonance assignment via Multicanonical Monte Carlo search using an ABACUS approach
    A Lemak, CA Steren, CH Arrowsmith - Journal of biomolecular , 2008 - Springer
     
    2. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     
    3. Structural and mutational studies of a hyperthermophilic intein from DNA polymerase II of pyrococcus abyssi
    Z Du, J Liu, CD Albracht, A Hsu, W Chen - Journal of Biological , 2011 - ASBMB
     
    4. BIOCHEMICAL AND STRUCTURAL ANALYSIS OF SV40 LARGE T ANTIGEN: INSIGHTS INTO CHAPERONE MEDIATED INACTIVATION OF
    CK Williams - 2012 - etd.library.vanderbilt.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch