.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jo6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of E.coli NirD. To be Published
    Site NESGC
    PDB Id 2jo6 Target Id ET100
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8866,BIG_827, 2.102.10.10, 15139 Molecular Weight 12283.36 Da.
    Residues 108 Isoelectric Point 5.07
    Sequence msqwkdickiddilpetgvcallgdeqvaifrpyhsdqvfaisnidpffessvlsrgliaehqgelwva splkkqrfrlsdglcmedeqfsvkhyearvkdgvvqlrg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jo6
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Automated error-tolerant macromolecular structure determination from multidimensional nuclear Overhauser enhancement spectra and chemical shift assignments:
    JJ Kuszewski, RA Thottungal, GM Clore - Journal of biomolecular , 2008 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch